PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN23316.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRF
Protein Properties Length: 503aa    MW: 53865.9 Da    PI: 8.8495
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN23316.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.75.5e-25124167144
         WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                 d+epgrCrRtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  KHN23316.1 124 DPEPGRCRRTDGKKWRCSRDVAPNHKYCERHMHRGRPRSRKPVE 167
                 79***************************************998 PP

2QLQ54.34e-1972104234
         QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqa 34 
                 +FT aQ+ +L++Q+++yKy++a++PvP++Ll +
  KHN23316.1  72 PFTSAQWRELERQAMIYKYMMASVPVPHDLLTP 104
                 8*****************************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.4E-1171107IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.56772107IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088808.2E-1372103IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.739124168IPR014977WRC domain
PfamPF088791.7E-20125167IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 503 aa     Download sequence    Send to blast
MSFTNHINLV SGASSVLGPA IDAGCGAAPP APVRTLQPFD ISSYTSSPTS TTTTFNFKPP  60
SAGVMAASLG FPFTSAQWRE LERQAMIYKY MMASVPVPHD LLTPSSRSSC MDGGFNLRLA  120
NSTDPEPGRC RRTDGKKWRC SRDVAPNHKY CERHMHRGRP RSRKPVEVNT NSTTTPTSVN  180
NNNHQIKKAR HECNNNPFAT PDVTAAISNP TSRKNGSSPH FLGSTTTQPY LDSSLSLDNF  240
GLKAASFDSV ASVSANKEPR GLEWMLNGDP ISLGASDSQW QSLMHNKDGM TSVSSCNTTE  300
SQYLNSLALY NSGLEQQNRR HPLFLNPLVV PMENLQPEKP RGFIDAWSNA ESNANTNTTN  360
KNSAASIGKL SLSSLDLSMG GAAVNEDVGN VNMGLGLMEP NGKTHTGTKI SLSNWQNPAP  420
WVASSLGGPL AEVLRSSTVT ATTTTNEATS NTPSPATTTH AESPSGVLQK TLVSLSDSSN  480
NSSPRVASSR ANSEMALLRF QSN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003526749.10.0PREDICTED: growth-regulating factor 7-like isoform X1
SwissprotQ9FJB81e-39GRF7_ARATH; Growth-regulating factor 7
TrEMBLA0A0B2QPB00.0A0A0B2QPB0_GLYSO; Uncharacterized protein
STRINGGLYMA06G13960.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.12e-39growth-regulating factor 7
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]